| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J7SKG9
dbSWEET id: dbswt_1839
Accession: J7SKG9
Uniprot status: Unreviewed
Organism: Morganella morganii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Morganella.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J7SKG9|J7SKG9_MORMO|Unreviewed|Morganella morganii|92
MSDTKRPPHDHSRFIRCLGWVATFTAFCMYVSYIPQIMDNLAGHKTSPLQPLAAAFNCTL
WVIYGLKVKDLPVAVANAPGVLFGLAAMLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 19 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: J7SKG9_inward.pdb Alignment file: J7SKG9_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 5.6% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J7SKG9_outward.pdb Alignment file: J7SKG9_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.0% allowed .8% week .8% disallowed Occluded: Model structure: J7SKG9_occluded.pdb Alignment file: J7SKG9_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 1.6% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA