| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J6I465
dbSWEET id: dbswt_1837
Accession: J6I465
Uniprot status: Unreviewed
Organism: Selenomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.
Sequence Information back to top
Sequence length: 81
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J6I465|J6I465_9FIRM|Unreviewed|Selenomonas|81
MSIVGVIASGLSICMYVSYIPQILGNLSGHQGDWIQPFVAFINCTMWVGYGFFKKQRDWP
LVIANSPGIIFGLTAAITARL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: J6I465_inward.pdb Alignment file: J6I465_inw.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 11.3% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: J6I465_outward.pdb Alignment file: J6I465_out.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 8.1% allowed .0% week .8% disallowed Occluded: Model structure: J6I465_occluded.pdb Alignment file: J6I465_occ.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 7.3% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA