Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : J6HK91
dbSWEET id: dbswt_2005
Accession: J6HK91
Uniprot status: Unreviewed
Organism: Selenomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.
Sequence Information back to top
Sequence length: 111
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J6HK91|J6HK91_9FIRM|Unreviewed|Selenomonas| 111
METPLKKMESESEHVEKKAANLGKSAVQDKMKVVGTIGSILSVCMYVSYIPQIIGNLSGH
PGDWIQPFVAFINCTIWVAYGFFKQQRDWPIVIANSPGIVFGLTTALTALF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: J6HK91_inward.pdb Alignment file: J6HK91_inw.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J6HK91_outward.pdb Alignment file: J6HK91_out.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 10.5% allowed .8% week .8% disallowed Occluded: Model structure: J6HK91_occluded.pdb Alignment file: J6HK91_occ.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 5.6% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA