| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J4X7A2
dbSWEET id: dbswt_1833
Accession: J4X7A2
Uniprot status: Unreviewed
Organism: Selenomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.
Sequence Information back to top
Sequence length: 81
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J4X7A2|J4X7A2_9FIRM|Unreviewed|Selenomonas|81
MSIVGVIASGLSVCMYVSYIPQIIGNLSGHPGDWIQPSVAFINCTMWVGYGFFKKQRDWP
IVLANLPGIIFGLTAAITARL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: J4X7A2_inward.pdb Alignment file: J4X7A2_inw.pir Procheck score ⇒ Ramachandran plot: 86.1% favored 12.3% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J4X7A2_outward.pdb Alignment file: J4X7A2_out.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 9.0% allowed .0% week .8% disallowed Occluded: Model structure: J4X7A2_occluded.pdb Alignment file: J4X7A2_occ.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 7.4% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA