Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J4X7A2

dbSWEET id: dbswt_1833

Accession:   J4X7A2

Uniprot status:   Unreviewed

Organism:   Selenomonas

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.

Sequence Information back to top


Sequence length:   81

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|J4X7A2|J4X7A2_9FIRM|Unreviewed|Selenomonas|81
MSIVGVIASGLSVCMYVSYIPQIIGNLSGHPGDWIQPSVAFINCTMWVGYGFFKKQRDWP
IVLANLPGIIFGLTAAITARL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  J4X7A2_inward.pdb    Alignment file: J4X7A2_inw.pir

Procheck score ⇒ Ramachandran plot: 86.1% favored    12.3% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  J4X7A2_outward.pdb    Alignment file: J4X7A2_out.pir

Procheck score ⇒ Ramachandran plot: 90.2% favored    9.0% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  J4X7A2_occluded.pdb    Alignment file: J4X7A2_occ.pir

Procheck score ⇒ Ramachandran plot: 90.2% favored    7.4% allowed    .8% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur