Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J3N8K5

dbSWEET id: dbswt_331

Accession:   J3N8K5

Uniprot status:   Unreviewed

Organism:   Oryza brachyantha

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   310

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   TSVS           CVV:   344       CHI:   1.9

Fasta sequence:

>tr|J3N8K5|J3N8K5_ORYBR|Unreviewed|Oryza_brachyantha|310
MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLW
IYYALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILL
LTLLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVV
WFLYGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRSTMVAKEVEATATDDDDAA
SPTAGVKEHVVNIAKLSAAAAIDVKTREVHPVESPPAEDHPSVAAAGSPPPPEDDKSGAA
VEKKAGQEEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: J3N8K5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  J3N8K5_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.3% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  J3N8K5_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  J3N8K5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    4.3% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   102721405     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur