| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J3MUS0
dbSWEET id: dbswt_71
Accession: J3MUS0
Uniprot status: Unreviewed
Organism: Oryza brachyantha
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 303
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|J3MUS0|J3MUS0_ORYBR|Unreviewed|Oryza_brachyantha|303
MAGGFLSLANPAVTLSGIAGNIISFLVFLAPVATFVQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIILYLTYAPRRARLRTLAFFLLLDVAAFALI
VAVTLYLIPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA
VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPANTAVLPTTSDAMSPAAAATQ
RIIELPAGTHAFTILSVSPVPILGVHKVEVVAAEQPDAAAAAADKDLQLLQNKPEVIEIA
AAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: J3MUS0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: J3MUS0_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: J3MUS0_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: J3MUS0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 5.3% allowed .0% week .0% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA