Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J3MUS0

dbSWEET id: dbswt_71

Accession:   J3MUS0

Uniprot status:   Unreviewed

Organism:   Oryza brachyantha

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   303

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|J3MUS0|J3MUS0_ORYBR|Unreviewed|Oryza_brachyantha|303
MAGGFLSLANPAVTLSGIAGNIISFLVFLAPVATFVQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIILYLTYAPRRARLRTLAFFLLLDVAAFALI
VAVTLYLIPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA
VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPANTAVLPTTSDAMSPAAAATQ
RIIELPAGTHAFTILSVSPVPILGVHKVEVVAAEQPDAAAAAADKDLQLLQNKPEVIEIA
AAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: J3MUS0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  J3MUS0_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  J3MUS0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.0% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  J3MUS0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    5.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0006825 - copper ion transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur