| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J3MA99
dbSWEET id: dbswt_914
Accession: J3MA99
Uniprot status: Unreviewed
Organism: Oryza brachyantha
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 239
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|J3MA99|J3MA99_ORYBR|Unreviewed|Oryza_brachyantha|239
MVNPDAVRNVVGIIGNFISFGLFLAPVPTFVTIVKKKDVEEFVPDPYLATFLNCALWVLY
GLPLVHPNSILVATINGVGLLIEIAYLAIYFAYAPRPKRCKMLAVLAVELVFLAAVAAAV
LLGAHTYDKRSLVVGSLCVFFGTLMYAAPLTIMKQVIATKSVEYMPFTLSLVSFINGICW
TIYALIRFDIFITIPNGMGTLLGAAQLILYFCYYGSTPKAGDDRSLQLPAKDGSAHSAV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: J3MA99.pir
Inward Open:
Template: 5CTG.pdb
Model structure: J3MA99_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: J3MA99_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: J3MA99_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed .5% week 1.1% disallowed
Gene Informationback to top
Gene ID: 102720049 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA