Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J3LD74

dbSWEET id: dbswt_292

Accession:   J3LD74

Uniprot status:   Unreviewed

Organism:   Oryza brachyantha

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   319

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|J3LD74|J3LD74_ORYBR|Unreviewed|Oryza_brachyantha|319
MAFLSMERNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML
WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIA
LVTLLLPQGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV
IWFGYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRTKKPPASSSSSAAAGQEIKLPEHV
KEVTTIVAKAGAAPPEGRASCGAEVHPIDDALPAPTVVEVKVDEEANRTDGVDVDDGDHG
ILLRPEQIIKPDMAIVVEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   217

Alignment file: J3LD74.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  J3LD74_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.4% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  J3LD74_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.4% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  J3LD74_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   102707553     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur