| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J3JYD4
dbSWEET id: dbswt_1205
Accession: J3JYD4
Uniprot status: Unreviewed
Organism: Dendroctonus ponderosae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Curculionidae ⇒ Scolytinae ⇒ Dendroctonus.
Sequence Information back to top
Sequence length: 216
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|J3JYD4|J3JYD4_DENPD|Unreviewed|Dendroctonus_ponderosae|216
MLDEQLKNLLATTASISTVLQFLSGTITCQRIVRNKSTGEISAFPFVSGCLSTALWLRYG
FLIQDTSIILVNTIGVSLFFSYVLVLFLYSIKKIQVLRQFLLSLGLLVAVLMKLHRMEDG
AQAHQFLGYTCMAVTVLFFAAPFATLLQVIRSKSTDSLPYHLIVATFLVSLQWLIYGLML
QDPFIQAPNFLGCVLSGLQLSLFLIYPAKAHGASVI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: J3JYD4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: J3JYD4_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 5.8% allowed 3.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: J3JYD4_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.7% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: J3JYD4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 7.9% allowed 1.6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA