Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J3JW37

dbSWEET id: dbswt_1204

Accession:   J3JW37

Uniprot status:   Unreviewed

Organism:   Dendroctonus ponderosae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Curculionidae ⇒ Scolytinae ⇒ Dendroctonus.

Sequence Information back to top


Sequence length:   232

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   QILV           CVV:   467       CHI:   9

Fasta sequence:

>tr|J3JW37|J3JW37_DENPD|Unreviewed|Dendroctonus_ponderosae|232
MEALSQSLQPYKELVGSVASYVTIAQFFSGAFVCKDIYKKGSTQGCSPMPFIGGVTIAIL
MLKYGLLVNDSAMITVNVAAIFLNSIYSLFFYKYAADKYEEVLKPVAYGVATLAVFLGYA
QLENPENLEYRFGLVLTLLMLALIGAPLLDVKNMIANQDASSIPLPITLMGAIVTFLWLI
YGIILLNVFMIIQNCIGFILCIVQLGLLFKYPGRISSSGGQSKKTEPAKKEQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   213

Alignment file: J3JW37.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  J3JW37_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    7.7% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  J3JW37_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.5% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  J3JW37_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.7% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur