| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J3JW37
dbSWEET id: dbswt_1204
Accession: J3JW37
Uniprot status: Unreviewed
Organism: Dendroctonus ponderosae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Curculionidae ⇒ Scolytinae ⇒ Dendroctonus.
Sequence Information back to top
Sequence length: 232
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: QILV CVV: 467 CHI: 9
Fasta sequence:
>tr|J3JW37|J3JW37_DENPD|Unreviewed|Dendroctonus_ponderosae|232
MEALSQSLQPYKELVGSVASYVTIAQFFSGAFVCKDIYKKGSTQGCSPMPFIGGVTIAIL
MLKYGLLVNDSAMITVNVAAIFLNSIYSLFFYKYAADKYEEVLKPVAYGVATLAVFLGYA
QLENPENLEYRFGLVLTLLMLALIGAPLLDVKNMIANQDASSIPLPITLMGAIVTFLWLI
YGIILLNVFMIIQNCIGFILCIVQLGLLFKYPGRISSSGGQSKKTEPAKKEQ
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 213
Alignment file: J3JW37.pir
Inward Open:
Template: 5CTG.pdb
Model structure: J3JW37_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 7.7% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: J3JW37_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 5.5% allowed .5% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: J3JW37_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.7% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5