Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J2VSV8

dbSWEET id: dbswt_1828

Accession:   J2VSV8

Uniprot status:   Unreviewed

Organism:   Herbaspirillum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Oxalobacteraceae ⇒ Herbaspirillum.

Sequence Information back to top


Sequence length:   123

Substrate Binding Site:   SSSS           CVV:   292       CHI:   -3.2

Selectivity Filter:   TATA           CVV:   320       CHI:   2.2

Fasta sequence:

>tr|J2VSV8|J2VSV8_9BURK|Unreviewed|Herbaspirillum| 123
MRIPEALTMDLSYSNLRTRLTAMATVEAHDDAMKPELTDLIGWGATIVLLLTISSQVYQQ
WRSRSTQGVSHWLFAGQLVASAGFVTYSMLQGDVVFVVSNIFLLLTALLGQVLYLRNRRR
NDQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   39     Model end:   115

Inward Open:

Template:   4X5M.pdb

Model structure:  J2VSV8_inward.pdb    Alignment file: J2VSV8_inw.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  J2VSV8_outward.pdb    Alignment file: J2VSV8_out.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    2.2% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  J2VSV8_occluded.pdb    Alignment file: J2VSV8_occ.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    3.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur