Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J2IZG5

dbSWEET id: dbswt_1827

Accession:   J2IZG5

Uniprot status:   Unreviewed

Organism:   Flavobacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Flavobacterium.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|J2IZG5|J2IZG5_FLASC|Unreviewed|Flavobacterium|97
MWEDKILKLKTMNFIDLIGLFAGMCVTISVIPQIVKVWKTKKVKAISLLTFSILTFGIMM
WIIYGVLKNDLPIIITNSVSLFLNLIMIYFIIYYEKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  J2IZG5_inward.pdb    Alignment file: J2IZG5_inw.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.1% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  J2IZG5_outward.pdb    Alignment file: J2IZG5_out.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.5% allowed    1.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  J2IZG5_occluded.pdb    Alignment file: J2IZG5_occ.pir

Procheck score ⇒ Ramachandran plot: 98.6% favored    1.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur