Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J2CQI5

dbSWEET id: dbswt_1826

Accession:   J2CQI5

Uniprot status:   Unreviewed

Organism:   Sphingobium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Sphingobium.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   TNTN           CVV:   378       CHI:   -8.4

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|J2CQI5|J2CQI5_9SPHN|Unreviewed|Sphingobium|89
MAGHLDERTLRVVGWFATITCILMYGAYLDQIRMNLAGDKGSVIQPLATVLNTCLWAAYG
WLHKEKDWPIIVANVPGIILGAVCLYTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   90

Inward Open:

Template:   4X5M.pdb

Model structure:  J2CQI5_inward.pdb    Alignment file: J2CQI5_inw.pir

Procheck score ⇒ Ramachandran plot: 86.2% favored    11.5% allowed    2.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  J2CQI5_outward.pdb    Alignment file: J2CQI5_out.pir

Procheck score ⇒ Ramachandran plot: 88.5% favored    10.0% allowed    1.5% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  J2CQI5_occluded.pdb    Alignment file: J2CQI5_occ.pir

Procheck score ⇒ Ramachandran plot: 89.2% favored    8.5% allowed    1.5% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur