| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J2CQI5
dbSWEET id: dbswt_1826
Accession: J2CQI5
Uniprot status: Unreviewed
Organism: Sphingobium
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Sphingobium.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: TNTN CVV: 378 CHI: -8.4
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|J2CQI5|J2CQI5_9SPHN|Unreviewed|Sphingobium|89
MAGHLDERTLRVVGWFATITCILMYGAYLDQIRMNLAGDKGSVIQPLATVLNTCLWAAYG
WLHKEKDWPIIVANVPGIILGAVCLYTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 14 Model end: 90 Inward Open: Template: 4X5M.pdb Model structure: J2CQI5_inward.pdb Alignment file: J2CQI5_inw.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 11.5% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J2CQI5_outward.pdb Alignment file: J2CQI5_out.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 10.0% allowed 1.5% week .0% disallowed Occluded: Model structure: J2CQI5_occluded.pdb Alignment file: J2CQI5_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 8.5% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA