| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J0L8L7
dbSWEET id: dbswt_1825
Accession: J0L8L7
Uniprot status: Unreviewed
Organism: Lactobacillus mali
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J0L8L7|J0L8L7_9LACO|Unreviewed|Lactobacillus mali| 104
MRIDTSKYPEGEDAVSADRIRRLKLLSKLATVMCIAMYISYIPQIISNFSGQPVGFLQPF
VAMVNASLWTGYGWNKTYKDWPVIISNVPGIFFGLFTVITIYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: J0L8L7_inward.pdb Alignment file: J0L8L7_inw.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 11.1% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J0L8L7_outward.pdb Alignment file: J0L8L7_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 4.0% allowed 2.4% week .0% disallowed Occluded: Model structure: J0L8L7_occluded.pdb Alignment file: J0L8L7_occ.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA