| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I3T974
dbSWEET id: dbswt_729
Accession: I3T974
Uniprot status: Unreviewed
Organism: Lotus japonicus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Loteae ⇒ Lotus.
Sequence Information back to top
Sequence length: 247
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|I3T974|I3T974_LOTJA|Unreviewed|Lotus_japonicus|247
MNVPHFVFGIFGNASALFLFLAPVITFKRIITNRSTEEFSGFPYVMTLLNCLLSAWYGLP
FVSPDNILVSTVNGTGAAIEIVYVLIFITLAPKKEKAKIFCLFTFVLLVFSVVIFVSLCA
LHGNSRKLFCGFAAAIFSAIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFG
LIGHDPFVAVPNGIGSILGTMQLILYFIYRDKKCVPRKQATTKEESMETGHAKPHKEKQP
NANGAQA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: I3T974.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I3T974_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 3.8% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I3T974_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 4.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I3T974_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 4.9% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA