Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I3T8J6

dbSWEET id: dbswt_636

Accession:   I3T8J6

Uniprot status:   Unreviewed

Organism:   Lotus japonicus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Loteae ⇒ Lotus.

Sequence Information back to top


Sequence length:   235

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|I3T8J6|I3T8J6_LOTJA|Unreviewed|Lotus_japonicus|235
MSMLAAFFISQVAKDAAGIAGNIFAFGLFLSPIPTFRRITRNGSTEMFSGLPYIYSLMNC
FICLWYGTPLVSRDNLLVTTVNSIGAVFQSVYIILFLMYAEKEKKVRLLGLLLAVLGIFA
IILIGSLQIPDIEMRRDFVGFLSCASLISMFASPLFIIKLVIQTKSIEFMPFYLSLSTFL
MSTSFLLYGLFNDDAFIYVPNGIGTILGVVQLILYFYYESKSRKESGEPLMVSYA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: I3T8J6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I3T8J6_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.2% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I3T8J6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I3T8J6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur