| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I3T803
dbSWEET id: dbswt_173
Accession: I3T803
Uniprot status: Unreviewed
Organism: Lotus japonicus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Loteae ⇒ Lotus.
Sequence Information back to top
Sequence length: 247
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|I3T803|I3T803_LOTJA|Unreviewed|Lotus_japonicus|247
MAMTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIY
YAFVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLA
TLYLSKGAKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMW
FFYGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVIEEKVKGQEMSGDHIIDVAK
GGAVSKV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: I3T803.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I3T803_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.7% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I3T803_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.7% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I3T803_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.2% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22