Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I3T4N0

dbSWEET id: dbswt_255

Accession:   I3T4N0

Uniprot status:   Unreviewed

Organism:   Lotus japonicus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Loteae ⇒ Lotus.

Sequence Information back to top


Sequence length:   260

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|I3T4N0|I3T4N0_LOTJA|Unreviewed|Lotus_japonicus|260
MISNSEREMVLIFGLLGNIVSFMVFLAPLPTFYTIYKKKPSEGFQSIPYVVALLSAMLLL
YYGFLKTNALLIITINCIGCAIEVSYLMMYIIYAPKKQKISTLLLILMADIGGLGLTMII
TMFVVKSAERVHAVGLICAIFNIAVFAAPLSTMRKVIKTRSVEYMPFSLSLFLTLCATMW
FFYGLFDKDNYIMMPNVLGFLFGISQMILYIIYKNAKKKVEVEATEQQEWGNTEKPAQHS
NDGNNKLVLPSVVEMKEYIV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: I3T4N0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I3T4N0_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    3.2% allowed    2.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I3T4N0_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    4.7% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I3T4N0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    4.7% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur