Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I3T0T2
dbSWEET id: dbswt_412
Accession: I3T0T2
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 278
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: CSVS CVV: 337 CHI: 5.1
Fasta sequence:
>tr|I3T0T2|I3T0T2_MEDTR|Unreviewed|Medicago_truncatula|278
MVHRDNTAIFVVGILGNIASFFCFIAPVSIFYQVCKKKTTGGFQSAPYVAALFSAMLWIF
YAYIKTGEMLIITINAFGCVIETIYLVIYTTYCSKKARIFTLKLIGLFNLGGICLVIILT
HVLAKERTERIELLGWICVVLSTSVFAAPLSVMRVVIRTKSVEFMPFTLSLLLTTSAIIW
LCYGILLKDIFVTLPNFVGITFGTIQMVLYAIYRKNKPVNDQKLPEHKDDMNENQLQVVV
IPLQNVVDIETTMENKEEKKQEETKPSEGNQVQQQKEG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: I3T0T2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I3T0T2_inward.pdb
Procheck score ⇒ Ramachandran plot: 84.5% favored 8.8% allowed 4.1% week 2.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I3T0T2_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 6.2% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I3T0T2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.7% favored 7.8% allowed .5% week 1.0% disallowed
Gene Informationback to top
Gene ID: 25501984 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22