| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I3SLY1
dbSWEET id: dbswt_638
Accession: I3SLY1
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 236
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|I3SLY1|I3SLY1_MEDTR|Unreviewed|Medicago_truncatula|236
MSVFASLAICKVAKDAAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLMNC
LICMWYGTPLISHDNILVTTVNSIGAVFQFVYIILFMMSAEKEKKVKMLAWLMGVLGIFA
IILIGSLQIDDIVMRRLFVGILSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFL
MSTSFLVYGLLSDDIFIYVPNEIGTILGMTQLILYFYYESKSRRMDAEDPLIVSYA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: I3SLY1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I3SLY1_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I3SLY1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I3SLY1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA