Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I3SGB9

dbSWEET id: dbswt_123

Accession:   I3SGB9

Uniprot status:   Unreviewed

Organism:   Lotus japonicus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Loteae ⇒ Lotus.

Sequence Information back to top


Sequence length:   260

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|I3SGB9|I3SGB9_LOTJA|Unreviewed|Lotus_japonicus|260
MALSHNTLAFTFGMLGNVISFMVFLAPIATFYRIYKKKSTEGFQSLPYLVALFSSMLWLY
YAMVKKDAFLLITINSFGCVIEIIYIILYMIYAPRDARNLTLKLFTAMNVGSFALILLVT
HFAVHGPLRVQVLGWICVSIAVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWF
GYGLFLKDICIALPNILGFGLGLIQMVLYAIYRNGNEKGKKPAAALKSVVIEIPTSNVIG
EEVGEEKEKTEEPPVNACAA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: I3SGB9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I3SGB9_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    2.6% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I3SGB9_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I3SGB9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.7% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur