| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I3D2P6
dbSWEET id: dbswt_2079
Accession: I3D2P6
Uniprot status: Unreviewed
Organism: Candidatus Nitrosopumilus
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae;Nitrosopumilus.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|I3D2P6|I3D2P6_9ARCH|Unreviewed|Candidatus Nitrosopumilus|94
MEVDGLLLTMLGITAGVLILMGWVEQIYKGYKTKRLKDVSKFLMIFIAAGSILWLIYGII
VEDVFIIGTNMSGLILMIIVLGMKKRYDIQAKTS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: I3D2P6_inward.pdb Alignment file: I3D2P6_inw.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 4.5% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: I3D2P6_outward.pdb Alignment file: I3D2P6_out.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 6.1% allowed .0% week .0% disallowed Occluded: Model structure: I3D2P6_occluded.pdb Alignment file: I3D2P6_occ.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 5.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA