Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I3D2P6

dbSWEET id: dbswt_2079

Accession:   I3D2P6

Uniprot status:   Unreviewed

Organism:   Candidatus Nitrosopumilus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae;Nitrosopumilus.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|I3D2P6|I3D2P6_9ARCH|Unreviewed|Candidatus Nitrosopumilus|94
MEVDGLLLTMLGITAGVLILMGWVEQIYKGYKTKRLKDVSKFLMIFIAAGSILWLIYGII
VEDVFIIGTNMSGLILMIIVLGMKKRYDIQAKTS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  I3D2P6_inward.pdb    Alignment file: I3D2P6_inw.pir

Procheck score ⇒ Ramachandran plot: 93.9% favored    4.5% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  I3D2P6_outward.pdb    Alignment file: I3D2P6_out.pir

Procheck score ⇒ Ramachandran plot: 93.9% favored    6.1% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  I3D2P6_occluded.pdb    Alignment file: I3D2P6_occ.pir

Procheck score ⇒ Ramachandran plot: 94.7% favored    5.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur