Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I2JD43

dbSWEET id: dbswt_1821

Accession:   I2JD43

Uniprot status:   Unreviewed

Organism:   Streptococcus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|I2JD43|I2JD43_9STRE|Unreviewed|Streptococcus|87
MTKQRINQIVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVVLGGLTFLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  I2JD43_inward.pdb    Alignment file: I2JD43_inw.pir

Procheck score ⇒ Ramachandran plot: 81.7% favored    14.3% allowed    2.4% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  I2JD43_outward.pdb    Alignment file: I2JD43_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    8.7% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  I2JD43_occluded.pdb    Alignment file: I2JD43_occ.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    8.7% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur