Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1ZKR6
dbSWEET id: dbswt_1819
Accession: I1ZKR6
Uniprot status: Unreviewed
Organism: Streptococcus parasanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|I1ZKR6|I1ZKR6_STRPA|Unreviewed|Streptococcus parasanguinis|85
MNEKQMKILGWVATFMSVMMYVSYFPQIVDNLAGHKGNFVQPLVAAINCSLWVYYGLFKK
ERDIPLAAANAPGIIFGLITAITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: I1ZKR6_inward.pdb Alignment file: I1ZKR6_inw.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: I1ZKR6_outward.pdb Alignment file: I1ZKR6_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 3.8% allowed 3.1% week .0% disallowed Occluded: Model structure: I1ZKR6_occluded.pdb Alignment file: I1ZKR6_occ.pir Procheck score ⇒ Ramachandran plot: 86.9% favored 11.5% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA