Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1YRS1
dbSWEET id: dbswt_1818
Accession: I1YRS1
Uniprot status: Unreviewed
Organism: Prevotella intermedia
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|I1YRS1|I1YRS1_PREI7|Unreviewed|Prevotella intermedia|86
MTKEKFFGNMGWAGMVTSILMYVFYFPQIENNLAGHKGTFIQPFMAGINCTLWVCYGLFK
EKRDWPIVIANVPGVIFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: I1YRS1_inward.pdb Alignment file: I1YRS1_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: I1YRS1_outward.pdb Alignment file: I1YRS1_out.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed .0% week 1.6% disallowed Occluded: Model structure: I1YRS1_occluded.pdb Alignment file: I1YRS1_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 4.8% allowed .8% week 2.4% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA