| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1PTD3
dbSWEET id: dbswt_536
Accession: I1PTD3
Uniprot status: Unreviewed
Organism: Oryza glaberrima
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|I1PTD3|I1PTD3_ORYGL|Unreviewed|Oryza_glaberrima|246
MFPDIRFIVGIIGSVACMLLYSAPILTFKRVIKKASVEEFSCIPYILALFSCLTYSWYGF
PVVSYGWENLTVCSISSLGVLFEGTFISIYVWFAPRGKKKQVMLMASLILAVFCMTVFFS
SFSIHNHHIRKVFVGSVGLVSSISMYGSPLVAMKQVIRTKSVEFMPFYLSLFTLFTSLTW
MAYGVIGTDPFIATPNCIGSIMGILQLVVYCIYSKCKEAPKVLHDIEQANVVKIPTSHVD
TKGHNP
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: I1PTD3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1PTD3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.3% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1PTD3_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1PTD3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.8% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA