Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1PB98

dbSWEET id: dbswt_313

Accession:   I1PB98

Uniprot status:   Unreviewed

Organism:   Oryza glaberrima

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   302

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|I1PB98|I1PB98_ORYGL|Unreviewed|Oryza_glaberrima|302
MVQALVFAVGIVGNILSFLVILAPVPTFYRVYKKKSTESFQSVPYAVALLSAMLWLYYAL
LTSDLLLLSINSIGCLVESLYLTVYLLYAPRQAMAFTLKLVCAMNLALFAAVVTALQLLV
KAADRRVTLAGGIGASFALAVFVAPLTIIRQVIRTKSVEFMPFWLSFFLTLSAVVWFFYG
LLMKDLFVATPNVLGLLFGLAQMVLYVVYKNPKKNSAVSEAAAAQQVEVKDQQQLQMQLQ
ASPAVAPLDVDADADADADLEAAAPATPQRPADDDAIDHRSVVVDIPPPPQPPPALPAVE
VA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: I1PB98.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1PB98_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    3.1% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1PB98_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.2% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1PB98_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0032588 - trans-Golgi network membrane

GO:0012506 - vesicle membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0071836 - nectar secretion

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur