Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1NBW1

dbSWEET id: dbswt_455

Accession:   I1NBW1

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   307

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VCMN           CVV:   411       CHI:   5.1

Fasta sequence:

>tr|I1NBW1|I1NBW1_SOYBN|Unreviewed|Glycine_max|307
MSNSSMASLTFAVGIIGTVLSLLVFASPIKTFCRVVKKKSTENYKGAPYITTFLCTSLWT
SYGVLKPGGFQIAIVNGAGAVFHCTYIILFLVYSPQDQKVKTALWVAILDVGFLGTVISV
TLFALHGTIQLSVLGMFCSGLTIIMYASPLLSMKMVIQTKSVEYMPFLLSFFMFLNAGVW
ALYSFLVKDFFIGIPNLIGLILGSTQLTVYVVYKKKQPEATKGPRVGLSLGKGASNYEEA
QLKDETVKVVVVEKALKKVKSLPKPVLNHEHILKKTLSFGVNNLPSTFWSTKPQQEDVAV
DAEEAQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: I1NBW1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1NBW1_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    3.8% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1NBW1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.3% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1NBW1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   100802750     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur