| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1LXA6
dbSWEET id: dbswt_714
Accession: I1LXA6
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 248
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|I1LXA6|I1LXA6_SOYBN|Unreviewed|Glycine_max|248
MDVAHFIFGIFGNASGLFLFLAPIVTFWRIVSNKSTEKFSGVPYPMTLLNCLLSAWYGLP
FVSPNNLLVTIINGTGAGIEIIYVFIFIYFAPKKEKTKIIGLFSFVVAVFSVVVLVSLFA
LQGNARKLFCGFAAAIFSIVMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIYG
LLGRDPFVAVPNGVGSALGTAQLILYFIYRDNKSDPKKIPRTEEEAMEMGTANKNPISNS
NGIQEGRV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: I1LXA6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1LXA6_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.3% allowed 1.1% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1LXA6_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 2.8% allowed 1.1% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1LXA6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 5.0% allowed .6% week .0% disallowed
Gene Informationback to top
Gene ID: 100777281 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA