Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1LX74

dbSWEET id: dbswt_553

Accession:   I1LX74

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   255

Substrate Binding Site:   CNWS           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|I1LX74|I1LX74_SOYBN|Unreviewed|Glycine_max|255
MAETLRMVVAVIGNVASVSLYAAPTVTFKRVIRKKSTEEFSCIPYIIALLNCLLFTWYGL
PVVSNKWENFPLVTVNGVGILFELSYVLIYFWFSTPKGKVKVAMTAVPVLIVFCVIAVVS
AFVFPDHRHRKLLVGSIGLGVSIAMYASPLVVMKKVIQTKSVEFMPLPLSFCSFLASVLW
LTYGLLIRDIFVAGPSVIGTPLGILQLVLHCKYWKRRVTEEPTKVELQKGNNAEKLDLEN
GHGKECVTVPSNFNS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: I1LX74.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1LX74_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    4.3% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1LX74_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.5% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1LX74_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.0% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   100785477     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur