| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1L0Y0
dbSWEET id: dbswt_499
Accession: I1L0Y0
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 244
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|I1L0Y0|I1L0Y0_SOYBN|Unreviewed|Glycine_max|244
MAEASFFVGVIGNIISILMFLSPVPTFWKIKKHGSTEDFSSLPYICTLLNCSLWTYYGII
KAGEYLVATVNGFGILMETIYIILFLIYAPKGIRGRTAILALILDVVILTAIIIITQLAL
EGETRSGAVGVMGAGLNIVMYSSPLSVMKTVVTTKSVEYMPFLLSFFFFFNGAVWLLYAV
LVRDVILGVPNGTGFLLGAMQLVLYAIYRNGKRVSNNRLEEGLQHEPLISEPNNESHQSE
DRPI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: I1L0Y0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1L0Y0_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.3% allowed 1.1% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1L0Y0_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.5% allowed 1.7% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1L0Y0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.5% allowed 1.7% week .6% disallowed
Gene Informationback to top
Gene ID: 100808537 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA