| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1KP49
dbSWEET id: dbswt_170
Accession: I1KP49
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 211
Substrate Binding Site: ANWS CVV: 399 CHI: -3.4
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|I1KP49|I1KP49_SOYBN|Unreviewed|Glycine_max|211
MTMHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY
YAFVKRETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLS
TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW
FFYGLLLRDYYVAVSSMLYSYLHIHFFFFYL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 212
Alignment file: I1KP49.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1KP49_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1KP49_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 6.3% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1KP49_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22