| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1KP47
dbSWEET id: dbswt_406
Accession: I1KP47
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 294
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: CTVS CVV: 357 CHI: 5.2
Fasta sequence:
>tr|I1KP47|I1KP47_SOYBN|Unreviewed|Glycine_max|294
MAHANPMIFVVGILGNLVSFCCFLAPVPTFYRVCKKKTTEGFQSLPYVAALFTSMLWIFY
AYIKTGEILLITINAFGCFIETVYLVIYITYCPKKARFFTFKMIFLFNVGVIFLVVLLTH
VLAKERTARIELLGWICVVLSTSVFAAPLSIIKVVIRTKSVEFMPITLSLLLTVSAMMWM
AYGILLRDIYVTLPNFVGITFGTIQIVLYLIYRKNKPVKDQKLPEHKDDVANDENVNTAV
SGENRGANATGFVDIEIGEKKQVQEQADKKQDQQAVNARDQTEHNNNSNKTREG
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 214
Alignment file: I1KP47.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1KP47_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 3.6% allowed 2.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1KP47_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.8% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1KP47_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 6.7% allowed 1.0% week .5% disallowed
Gene Informationback to top
Gene ID: 100801430 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22