Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1KBZ9

dbSWEET id: dbswt_165

Accession:   I1KBZ9

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   260

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|I1KBZ9|I1KBZ9_SOYBN|Unreviewed|Glycine_max|260
MAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIY
YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS
TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMW
FFYGLLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMKLQELNSHTIDVGKLSR
MEPSEPNHLTKNGTLTEREI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: I1KBZ9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1KBZ9_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    3.6% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1KBZ9_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.1% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1KBZ9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    5.1% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur