Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1KBZ9
dbSWEET id: dbswt_165
Accession: I1KBZ9
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 260
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|I1KBZ9|I1KBZ9_SOYBN|Unreviewed|Glycine_max|260
MAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIY
YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS
TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMW
FFYGLLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMKLQELNSHTIDVGKLSR
MEPSEPNHLTKNGTLTEREI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: I1KBZ9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1KBZ9_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 3.6% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1KBZ9_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.1% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1KBZ9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 5.1% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22