| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1KBZ7
dbSWEET id: dbswt_399
Accession: I1KBZ7
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 309
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: CSVS CVV: 337 CHI: 5.1
Fasta sequence:
>tr|I1KBZ7|I1KBZ7_SOYBN|Unreviewed|Glycine_max|309
MSHSHLSFAFGILGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFYA
YVKTGETLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTHL
LAKGEEARVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSLLLLISAIMWLL
YGISLKDIYVTLPNVVGLTFGVIQIGLYAMYRNNKPIKDQKLPEHKGDIVESENVIAPTG
NGEKQEEEVKPQGGDIEIGEKKEENNKQDQQQSVENKKLDQVAHDQTELNKNNINKNNNK
TEERVSCEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: I1KBZ7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1KBZ7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.8% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1KBZ7_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 4.2% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1KBZ7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.1% week 2.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22