Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1KAN3
dbSWEET id: dbswt_559
Accession: I1KAN3
Uniprot status: Unreviewed
Organism: Glycine max
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 254
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|I1KAN3|I1KAN3_SOYBN|Unreviewed|Glycine_max|254
MAETIRLAVAVLGNAASVALYAAPMVTFRRVIRKKSTEEFSCFPYIIGLLNCLLFTWYGL
PVVSYKWENFPLVTVNGVGIVLELSYVLIYFWYASAKGKVKVAMTAIPVLLVFSIIAAVS
AFAFHDNHHRKLLVGSIGLGVSVTMYGSPLIVMKKVIQTKSVEFMPLPLSMCSFLATVLW
LIYGLLIRDIFVAGPSAVGTPLGILQLVLYCKYRKGSVVEDPSKGDLEKGNLEKVEMEIG
KVEMNVTNHMNGHS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: I1KAN3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1KAN3_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.3% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1KAN3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.7% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1KAN3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.9% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 100813119 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA