Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1KAI7

dbSWEET id: dbswt_720

Accession:   I1KAI7

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   258

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|I1KAI7|I1KAI7_SOYBN|Unreviewed|Glycine_max|258
MDVAHFLFGIFGNASALFLFLAPVYALHSCFLPSLITFKRIIKNRSTEKFSGIPYVMTLL
NCLLSAWYGLPFVSPHNILVSTVNGTGSFIEIIYVLIFIVLAPRKEKAKILGLFTFVLSV
FSAVVFVSLFALHGNSRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFV
FLCGTSWFIFGLLGRDPFVAVPNGVGSALGTMQLILYFIYRDNKGVPRKQAPTEEESMEM
GDAKPQQGKQSNANGIQG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   222

Alignment file: I1KAI7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1KAI7_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.1% favored    6.7% allowed    3.1% week    2.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1KAI7_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    3.6% allowed    3.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1KAI7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.6% favored    5.2% allowed    4.1% week    1.0% disallowed

Gene Informationback to top


Gene ID:   100800304     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur