Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1IRM7
dbSWEET id: dbswt_49
Accession: I1IRM7
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 291
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|I1IRM7|I1IRM7_BRADI|Unreviewed|Brachypodium_distachyon|291
MAGALFSMAHPWASAFGILGNIISFLVFLAPTPTFLRVYRKKSTEGFSSVPYVVALFSCT
LWILYALVKTNSSPLLTINAFGCVVEAAYIVLYLVYAPRPARLRTLASFLLLNVAAFSLI
VAVTVFLVAPMHRVKVLGSICLAFSMAVFVAPLSVIFVVIKTKSAEYMPFSLSFFLTLSA
VAWFFYGLFTKDIYVTLPNVGGFFFGIAQMTLYFCYRKPGTSALVLPTSIDDVSTEPAAS
AAADQEVELPAGTHPAVAMLTVSTLPVLAELQKMEQEIGTPTPRKGYIKAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: I1IRM7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1IRM7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1IRM7_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1IRM7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 100845240 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA