Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1ILW8
dbSWEET id: dbswt_905
Accession: I1ILW8
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 241
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|I1ILW8|I1ILW8_BRADI|Unreviewed|Brachypodium_distachyon|241
MVNADEVRNIVGVMGNVISFGLFLSPLPTFIQIVQKKDVEKYAPDPYLATLLNCMLWVLY
GLPFVHPNSFLVITINGTGVVIESVYLAVFFAYSPGPKRIKLLIMLGVEVLFVAAVAAGV
LLGAHTFEDRSLVVGSICVFFGTLMYAAPLTVIKRVIATKSVEYMPLTLSLVSLLNSICW
TTYALIRFDIFITIPNGTGTLLCLGQLFLYFWYAGSTPMASDSSKVDDDGGSSVRSGGRA
A
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: I1ILW8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1ILW8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1ILW8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1ILW8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.8% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 100832485 Total Exons: 3 Coding Exons: 2
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA