| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1I9Z6
dbSWEET id: dbswt_302
Accession: I1I9Z6
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 309
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|I1I9Z6|I1I9Z6_BRADI|Unreviewed|Brachypodium_distachyon|309
MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLL
WMYYAFLKSGAELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIA
LVTMLVSAGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAV
IWFAYGLLKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHVKEVTT
NTKLGGAPTEGRISCGAEVHPIDVMPTSAAAGADEQAINVEEAAAGRDDHNMLRPEQVIK
PDMAIVVEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: I1I9Z6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1I9Z6_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.2% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1I9Z6_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1I9Z6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.3% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 100831573 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA