| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1I8Z2
dbSWEET id: dbswt_66
Accession: I1I8Z2
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 299
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|I1I8Z2|I1I8Z2_BRADI|Unreviewed|Brachypodium_distachyon|299
MAAGFLSMAHPAITLSGIAGNVISFLVFLAPVTTFVQVVRKKTTGGFSAVPYVVALFSST
LWILYALLKGNSRPLLTINGFGCGVELAYVVAYLLYAPRKARLRALAYFLALDVAAFAIV
AAVALLGVAPEHRVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPISLSFCLVLSA
VAWFCYGYFTKDPYVMYPNVGGFFFSCVQMGLYFYYRRPSNAAVLPTTADGATGGGAVQA
QVIELPPHAVAILSVSNIPILGMHKIEVMAAPEQQDAKAADIVDKAAPAPEAVEIAGTV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: I1I8Z2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1I8Z2_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1I8Z2_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1I8Z2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 100842461 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA