Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1HZI5

dbSWEET id: dbswt_833

Accession:   I1HZI5

Uniprot status:   Unreviewed

Organism:   Brachypodium distachyon

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.

Sequence Information back to top


Sequence length:   251

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|I1HZI5|I1HZI5_BRADI|Unreviewed|Brachypodium_distachyon|251
MVSPDTIRTAIGVVGNGTALVLFLSPVPTFYRIWKKRSVEQYSAVPYLATLLNCMIWVLY
GLPLVHPNSMLVITINGTGMAIELAYVALFLACSAGAARRRVLLILVAEVAFVAAVAALV
LALAHTYERRSMVVGILGVLFGTGMYAAPLSVMKMVIQTKSVEYMPLFLSLASLVNGICW
TAYALIRFDLYITIPNGLGVMFAVGQVILYAIYYKSTQQILEARKRKTDQVAMTEVVVDA
KNSGAGNGNYL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: I1HZI5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1HZI5_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.2% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1HZI5_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1HZI5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   100831049     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur