Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1HND8

dbSWEET id: dbswt_609

Accession:   I1HND8

Uniprot status:   Unreviewed

Organism:   Brachypodium distachyon

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.

Sequence Information back to top


Sequence length:   238

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|I1HND8|I1HND8_BRADI|Unreviewed|Brachypodium_distachyon|238
MASLGLPGVSSYHDLCCYGAGIVGNIFAFVLFISPLPTFKRIVRNGSTEQFSAMPYLYSL
LNCLVCMWYALPFVSYGVVLVATVNTIGAAFQLAYTAIFIAFADGKKRLKVSVLLAGVFC
LFGLIMYVSMALFDHKPRQTFVGYLSVVSLICMFASPLSIIKLVIKTKSVEYMPFYLSLA
MSLMSASFFAYGVLLHDFFIYIPNGIGTILGVIQLLLYAYFRKGSKEEARRPLLVTHT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   223

Alignment file: I1HND8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1HND8_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.8% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1HND8_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    5.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1HND8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.3% allowed    .0% week    .5% disallowed

Gene Informationback to top


Gene ID:   100846408     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur