Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1HKV5
dbSWEET id: dbswt_528
Accession: I1HKV5
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: SSWS CVV: 382 CHI: -3.3
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|I1HKV5|I1HKV5_BRADI|Unreviewed|Brachypodium_distachyon|250
MFPDLRVTTGIIGSVVCLLLYAAPILTFKRVIKKGSVEEYSCIPYILTLFSSLTYTWYGL
PVVSSGWENLTLSGISSLGVLFESTFISIYIWFAPRGKKKLVMAMVSSIVIIFGMAVFFS
SFSIHTHQMRKVFVGSIGLVASILMYGSPLVAVKQVIRTKSVEFMPFYLSLFSFLTSLLW
MLYGILGRDVFLTAPSCIGCLMGILQLVVYCMYNKCKESPKTNPDIEQADVVKVTTSQDD
TKGQKPLSES
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: I1HKV5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1HKV5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1HKV5_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.2% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1HKV5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.4% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 100843767 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA