Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1HKV5

dbSWEET id: dbswt_528

Accession:   I1HKV5

Uniprot status:   Unreviewed

Organism:   Brachypodium distachyon

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   SSWS           CVV:   382       CHI:   -3.3

Selectivity Filter:   LSMT           CVV:   414       CHI:   4.2

Fasta sequence:

>tr|I1HKV5|I1HKV5_BRADI|Unreviewed|Brachypodium_distachyon|250
MFPDLRVTTGIIGSVVCLLLYAAPILTFKRVIKKGSVEEYSCIPYILTLFSSLTYTWYGL
PVVSSGWENLTLSGISSLGVLFESTFISIYIWFAPRGKKKLVMAMVSSIVIIFGMAVFFS
SFSIHTHQMRKVFVGSIGLVASILMYGSPLVAVKQVIRTKSVEFMPFYLSLFSFLTSLLW
MLYGILGRDVFLTAPSCIGCLMGILQLVVYCMYNKCKESPKTNPDIEQADVVKVTTSQDD
TKGQKPLSES

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: I1HKV5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1HKV5_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    4.8% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1HKV5_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.2% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1HKV5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.4% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   100843767     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur