Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1H5M9

dbSWEET id: dbswt_437

Accession:   I1H5M9

Uniprot status:   Unreviewed

Organism:   Brachypodium distachyon

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.

Sequence Information back to top


Sequence length:   312

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VAMN           CVV:   392       CHI:   4.4

Fasta sequence:

>tr|I1H5M9|I1H5M9_BRADI|Unreviewed|Brachypodium_distachyon|312
MAADPSFFVGIVGNIISILVFTSPIGTFRRVVRNKSTEEFRWLPYVTTLLATSLWAFYGL
LKPGGLLIVPVNGAGAALQAIYVVLYLAYAPRETKIKMAKVVLAVNIVFFAAVIVVGLVA
LHGAVRLFAVGLLCAALTVGMYAAPMAAMRTVVKTRSVEYMPFFLSFFLFLNGGIWSVYS
MLVKDYFIGIPNAIGFAMGSAQLVLYMAYRNKKKAAAGALKVDEEDEEKGVVHLMGQVEL
SQRKASLKKGLSLPMPSSLPSPLHGFGNLIKALSATPLELHSVMHQHERVEISARDEEPN
DDRHTSGHRSDT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: I1H5M9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  I1H5M9_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    3.8% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  I1H5M9_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.6% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  I1H5M9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.0% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   100834766     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur