Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : I1H5I5
dbSWEET id: dbswt_319
Accession: I1H5I5
Uniprot status: Unreviewed
Organism: Brachypodium distachyon
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Brachypodieae ⇒ Brachypodium.
Sequence Information back to top
Sequence length: 298
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|I1H5I5|I1H5I5_BRADI|Unreviewed|Brachypodium_distachyon|298
MAAIGNPWVFAVGILGNILSFLVILAPVPTFHRVYKRKSTESFQSAPYAMALLSAMLWLY
YALLTADLLLLSINAVGCVVETAYLAVYLAYAPKQARAFTVKLVFVMNVALYGAMVAFLQ
LYVRDGDRRVAIAGGVGAAFAFAVFVAPLAIIRQVIRTKSVEFLPFWLSFFLTISAVVWF
FYGLLMKDFFVAMPNVLGLLFGLAQMALHLVYKNPKKKKGAVSEAGQAAVAADGEKQNQL
ELQQQHQQAAAATINADDAEDASKVQQSVTVVVDIPLPPPEEHPAPMPPPIRTAVEVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: I1H5I5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: I1H5I5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.7% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: I1H5I5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: I1H5I5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 100830282 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA