| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : I1DQU2
dbSWEET id: dbswt_1817
Accession: I1DQU2
Uniprot status: Unreviewed
Organism: Campylobacter concisus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|I1DQU2|I1DQU2_9PROT|Unreviewed|Campylobacter concisus|85
MSERNLQILGWIGTCLSVVMYFSYIPQIMGNLDGNKTPYIQPLAAALNCTIWTSYGLLKV
KKDYPLSAANLPGIIFGLLATITAF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: I1DQU2_inward.pdb Alignment file: I1DQU2_inw.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: I1DQU2_outward.pdb Alignment file: I1DQU2_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 6.3% allowed .8% week .0% disallowed Occluded: Model structure: I1DQU2_occluded.pdb Alignment file: I1DQU2_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA