Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I1DQU2

dbSWEET id: dbswt_1817

Accession:   I1DQU2

Uniprot status:   Unreviewed

Organism:   Campylobacter concisus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|I1DQU2|I1DQU2_9PROT|Unreviewed|Campylobacter concisus|85
MSERNLQILGWIGTCLSVVMYFSYIPQIMGNLDGNKTPYIQPLAAALNCTIWTSYGLLKV
KKDYPLSAANLPGIIFGLLATITAF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  I1DQU2_inward.pdb    Alignment file: I1DQU2_inw.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  I1DQU2_outward.pdb    Alignment file: I1DQU2_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.3% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  I1DQU2_occluded.pdb    Alignment file: I1DQU2_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur