Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : I0XRX9

dbSWEET id: dbswt_1816

Accession:   I0XRX9

Uniprot status:   Unreviewed

Organism:   Leptospira licerasiae

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|I0XRX9|I0XRX9_9LEPT|Unreviewed|Leptospira licerasiae|87
MDPISLLGFIACTLTTLAFLPQLIKVILEKRTRDISRNMYLVLSVGVFFWLCYGVLKNDF
PIILANAFTLIFTTTILWYKLRSKEEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  I0XRX9_inward.pdb    Alignment file: I0XRX9_inw.pir

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.0% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  I0XRX9_outward.pdb    Alignment file: I0XRX9_out.pir

Procheck score ⇒ Ramachandran plot: 90.7% favored    9.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  I0XRX9_occluded.pdb    Alignment file: I0XRX9_occ.pir

Procheck score ⇒ Ramachandran plot: 97.1% favored    2.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur