Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H9J046

dbSWEET id: dbswt_1201

Accession:   H9J046

Uniprot status:   Unreviewed

Organism:   Bombyx mori

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Lepidoptera ⇒ Glossata ⇒ Ditrysia ⇒ Bombycoidea ⇒ Bombycidae ⇒ Bombycinae ⇒ Bombyx.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|H9J046|H9J046_BOMMO|Unreviewed|Bombyx_mori|228
MDALADILQPYKEIVGSIAAFVTIGQMFSGSFICWDIYKQGSTRGIGIMPFLGGVVMTIL
NLQYGYILRDDTMIQVNMFGLALNIVYVLIYFNYTQQKVKVWAQIGLAGAVSAALIGYAQ
TEDPKLVETRFGTIITAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLY
GIILRNKFLVVQNVVALVLCASQLSLFVIYPSKPKGKDKSKVKAKKTE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   212

Alignment file: H9J046.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H9J046_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.3% favored    10.5% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H9J046_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.1% allowed    2.2% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H9J046_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.7% allowed    2.2% week    .6% disallowed

Gene Informationback to top


Gene ID:   101737091     Total Exons:   5     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur