| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : H9J046
dbSWEET id: dbswt_1201
Accession: H9J046
Uniprot status: Unreviewed
Organism: Bombyx mori
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Lepidoptera ⇒ Glossata ⇒ Ditrysia ⇒ Bombycoidea ⇒ Bombycidae ⇒ Bombycinae ⇒ Bombyx.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QMLV CVV: 467 CHI: 6.4
Fasta sequence:
>tr|H9J046|H9J046_BOMMO|Unreviewed|Bombyx_mori|228
MDALADILQPYKEIVGSIAAFVTIGQMFSGSFICWDIYKQGSTRGIGIMPFLGGVVMTIL
NLQYGYILRDDTMIQVNMFGLALNIVYVLIYFNYTQQKVKVWAQIGLAGAVSAALIGYAQ
TEDPKLVETRFGTIITAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLY
GIILRNKFLVVQNVVALVLCASQLSLFVIYPSKPKGKDKSKVKAKKTE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 212
Alignment file: H9J046.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H9J046_inward.pdb
Procheck score ⇒ Ramachandran plot: 87.3% favored 10.5% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H9J046_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 6.1% allowed 2.2% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H9J046_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 7.7% allowed 2.2% week .6% disallowed
Gene Informationback to top
Gene ID: 101737091 Total Exons: 5 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5