| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : H9ERI9
dbSWEET id: dbswt_1200
Accession: H9ERI9
Uniprot status: Unreviewed
Organism: Macaca mulatta
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Haplorrhini ⇒ Catarrhini ⇒ Cercopithecidae ⇒ Cercopithecinae ⇒ Macaca.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|H9ERI9|H9ERI9_MACMU|Unreviewed|Macaca_mulatta|221
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY
GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP
NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATVLTSASWCLYGF
RLRDPYIMVSNFPGIITSFIRFWLFWKYPQEQDRNYWFLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: H9ERI9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H9ERI9_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 4.9% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H9ERI9_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.6% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H9ERI9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 6.6% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA